PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_199974g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 210aa    MW: 24112.2 Da    PI: 8.3124
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_199974g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+  ++ +G g+W++ ++  g+ R++k+c++rw +yl
   MA_199974g0010 14 KGAWTKEEDDRLIAHIRAHGEGCWRSLPKDAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding59.38.4e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++eEdel+++++  lG++ W++Ia++++ gRt++++k++w+++
   MA_199974g0010  67 RGNFSEEEDELIIKLHSILGNK-WSLIAARLP-GRTDNEIKNYWNSH 111
                      89********************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.293961IPR017930Myb domain
SuperFamilySSF466892.62E-2913108IPR009057Homeodomain-like
SMARTSM007173.9E-131363IPR001005SANT/Myb domain
PfamPF002497.5E-151461IPR001005SANT/Myb domain
CDDcd001671.53E-101661No hitNo description
PROSITE profilePS5129429.03762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2865116IPR009057Homeodomain-like
SMARTSM007174.8E-1866114IPR001005SANT/Myb domain
PfamPF002493.7E-1767111IPR001005SANT/Myb domain
CDDcd001673.49E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MGRSPCCEKS HTNKGAWTKE EDDRLIAHIR AHGEGCWRSL PKDAGLLRCG KSCRLRWINY  60
LRPDLKRGNF SEEEDELIIK LHSILGNKWS LIAARLPGRT DNEIKNYWNS HIKRKLLSRG  120
LDPGSHRPLC FPHHNNTTSP SRPAPDHEFP AFQNLKTPEI TDFFQQHRSE SSPIVPEASD  180
AEEHPDLNLN LCISLPSNSP PRREESFQRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1028280.0BT102828.1 Picea glauca clone GQ0201_E19 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028718.11e-91PREDICTED: myb-related protein 308-like
SwissprotQ9SZP13e-88MYB4_ARATH; Transcription repressor MYB4
TrEMBLA5JYF41e-150A5JYF4_PICGL; R2R3-MYB transcription factor MYB10
STRINGGLYMA11G11450.19e-89(Glycine max)
STRINGLOC_Os09g36730.11e-88(Oryza sativa Japonica Group)
STRINGBGIOSGA029363-PA1e-88(Oryza sativa Indica Group)
STRINGORGLA09G0141200.11e-88(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-89myb domain protein 4